PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa11g003730.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 219aa    MW: 24209.4 Da    PI: 8.5813
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa11g003730.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.74e-1861115256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ ++tk+q   Le+ F+ +++++ ++++ LA++l+L  rqV vWFqNrRa+ k
  Csa11g003730.1  61 RKKLRLTKQQSALLEDSFKLHSTLNPKQKQTLARQLNLRPRQVEVWFQNRRARTK 115
                     788899***********************************************98 PP

2HD-ZIP_I/II123.41.1e-3961150191
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                     +kk+rl+k+q++lLE+sF+ +++L+p++K++lar+L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l++en+rL+ke ++L+ +l
  Csa11g003730.1  61 RKKLRLTKQQSALLEDSFKLHSTLNPKQKQTLARQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLTDENRRLQKELQDLK-AL 150
                     69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-1750111IPR009057Homeodomain-like
PROSITE profilePS5007117.03857117IPR001356Homeobox domain
SuperFamilySSF466893.21E-1859125IPR009057Homeodomain-like
SMARTSM003894.1E-1559121IPR001356Homeobox domain
PfamPF000461.4E-1561115IPR001356Homeobox domain
CDDcd000866.56E-1561118No hitNo description
PROSITE patternPS00027092115IPR017970Homeobox, conserved site
PfamPF021837.7E-10117151IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.4E-25117160IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MKNINPDIRV NGISSFSSGR VKREREICGG DGEEEAEETT ERVVCSRVSD DHEDEEGVSA  60
RKKLRLTKQQ SALLEDSFKL HSTLNPKQKQ TLARQLNLRP RQVEVWFQNR RARTKLKQTE  120
VDCEFLKKCC ETLTDENRRL QKELQDLKAL KLAQPFYMHM PAATLTMCPS CERLGGGGGT  180
GGAGGGTAAV DGETGKGAFS IVTKPRFYNP FTNPSAAC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1109117RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4412540.0AJ441254.1 Arabidopsis thaliana mRNA for homeodomain-leucine zipper protein HAT22.
GenBankATU093360.0U09336.1 Arabidopsis thaliana clone HAT22 homeobox protein mRNA, complete cds.
GenBankAY0875630.0AY087563.1 Arabidopsis thaliana clone 36691 mRNA, complete sequence.
GenBankBT0023180.0BT002318.1 Arabidopsis thaliana clone C105403 putative homeobox protein HAT22 (At4g37790) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010437184.11e-153PREDICTED: homeobox-leucine zipper protein HAT22
SwissprotP466041e-122HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLD7MA031e-123D7MA03_ARALL; Homeobox-leucine zipper protein 22
STRINGfgenesh2_kg.7__270__AT4G37790.11e-123(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16712886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.11e-117HD-ZIP family protein